AS2TS

From
Amino-acids Sequence to Tertiary Structure

AS2TS service is designed to facilitate the modeling of tertiary structure (3D model) for a given sequence of amino-acids.
Be aware that not for all proteins a correct 3D model can be produced using the current version of the system.
Please check HELP for more information about AS2TS service.

If you already have sequence-structure alignment generated you can use AL2TS server to build 3D model.
For AS2TS server the sequence of amino-acids should be introduced in FASTA format (see example): 


>Protein_name
MRFKLSVIIFVLVSASALATPSFNVGFSPSHTALENVLSVVNNAQSSLDVEAYTFTSK
QISTAIVSAQKRGVNVRVVADAKANRLNYSAIHYLAQQHVPVRLNNNYSIHHNKVMIA
DGDTIQTGSMNYTTNGDTHNAENVLVIRGAPEIAGKYQVEFNRLWA
If your sequence is a nucleotide (DNA/RNA) sequence, then you need to translate it to the protein sequence first (see ExPASy - Translate tool).

Email address (where a notice of completion will be sent)

Please Ensure Your E-Mail Address is Correct and Complete
Without a valid E-mail address you will not receive any results

Paste or type your protein sequence (FASTA format) into the box below.


Number of generated models   ( 1 <= N <= 40 )
Mutation matrix:   BL45    P250    BL50    BL62    BL80    PA70    PA30

Pairwise sequence alignment search (quick):   S-W    FASTA    BLAST
Multiple sequence alignment search (slow):   PSI-BLAST,    Number of iterations: ( 2 <= n <= 9 ),

Side chains building procedure (SCWRL) applied to first N models:    ( 0 <= N <= 40 ),

Note: side chain atom positions can also be calculated later. When your model is constructed you can use 'M' link to view the coordinates, copy and paste model to the page SCWRL - sidechain builder for AS2TS system, and run side chain building independently.

Please send any comments or suggestions concerning
the AS2TS facility to Adam Zemla : adamz@llnl.gov